Peak Revival Plus
ProductsAboutCompliance
Sign In
Back to Products
CJC-1295 (No DAC)

CJC-1295 (No DAC)

Modified GRF (1-29)

≥99%

Molecular Weight

3367.97 Da

Amino Acid Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Scientific Description

CJC-1295 without DAC is a modified growth hormone releasing factor studied in laboratory research for receptor binding and cellular signaling analysis. Used in controlled in vitro experiments.

Research Applications

Receptor binding studies, cellular signaling analysis, in vitro research

Storage Conditions

Store lyophilized at -20°C. Reconstituted solutions stable at 4°C for 7 days.

30% OFF with code PRPLUS30
04:00:00

Your discount expires soon - don't miss out!

29 people viewing now51+ bought in last 24 hours
$100
FREE Shipping
Add $15.00 more for free shipping

Order Information

CJC-1295 (No DAC)

CJC-1295 (No DAC) (10mg)

Ships today if ordered and paid by 12 PM PST. (Except Saturdays & Sundays)

1
$85.00
2xSave 4%
$81.60/ea
4xSave 8%
$78.20/ea
6xSave 11%
$75.65/ea
Total Price:
$85.00
Free 2-Day Shipping
≥98% Purity Guaranteed

Quality Certifications

≥98% Purity Guaranteed

All products meet strict purity standards

Certificate of Analysis

COA included with every order

HPLC Verified

Third-party lab testing for accuracy

GMP Standards

Manufactured following WHO guidelines

Certificate of Analysis (COA) Included

Every order includes a detailed COA with HPLC chromatogram, mass spectrometry data, and purity verification. Request the COA for CJC-1295 (No DAC) via email after purchase.

USA BasedSecure Checkout500+ Labs Served

Frequently Asked Questions

Common questions about CJC-1295 (No DAC) (Modified GRF (1-29)). Can't find what you're looking for? Contact our research support team.

CJC-1295 (No DAC), also known as Modified GRF (1-29), has a shorter half-life (~30 minutes) compared to the DAC version (~8 days). The No DAC variant produces more physiological, pulsatile GH release patterns, making it preferred in research studying natural growth hormone secretion dynamics. It is often studied in combination with Ipamorelin.

Reconstitute with bacteriostatic water. For a 2mg vial, add 1mL of BAC water for a 2mg/mL concentration. Inject slowly along the vial wall and gently swirl — never shake. Reconstituted solution is stable at 4°C for up to 7 days.

Lyophilized CJC-1295 (No DAC) maintains ≥95% stability for 24+ months at -20°C. After reconstitution, refrigerate at 4°C and use within 7 days.

Every batch is independently tested by accredited third-party laboratories with full Certificates of Analysis (COA) available on request. We guarantee ≥98% purity across our catalog, use pharmaceutical-grade lyophilization, and ship with cold-chain packaging to preserve compound integrity. Our research-grade peptides are manufactured under strict GMP-compliant conditions, ensuring consistency and reliability that many competitors cannot match.

Yes. We can provide HPLC, mass spectrometry, endotoxin testing, and amino acid analysis reports for any product. If you need a specific assay or custom testing protocol for your research, contact us at [email protected] and we will coordinate with our laboratory partners to accommodate your requirements.

Absolutely. We offer tiered pricing for research institutions, universities, and laboratories ordering in volume. Discounts typically start at 10+ units and scale with quantity. Contact us at [email protected] with your institutional details and estimated quantities for a custom quote. We also support purchase orders (PO) for qualifying institutions.

All orders ship within 1–2 business days via USPS Priority or UPS Ground with temperature-controlled packaging. Lyophilized peptides are shipped with cold packs to maintain stability. Domestic orders typically arrive within 3–5 business days. Tracking information is provided via email as soon as your order ships.

Due to the nature of research chemicals, we cannot accept returns on opened products. However, if your order arrives damaged, contaminated, or does not meet the stated purity specifications, we will replace it or issue a full refund. Please contact support within 48 hours of delivery with photos of any issues.

No. All products sold by Peak Revival Plus are strictly for in-vitro research and laboratory use only. They are not intended for human consumption, veterinary use, or any therapeutic application. By purchasing, you confirm that you understand and agree to these terms.

Trusted by Researchers

What Our Customers Say

Verified feedback from researchers and laboratories across the country

"Exceptional purity and consistency across batches. The COA documentation is thorough and matches our internal HPLC analysis. We've been ordering for our cellular signaling studies for over a year now."

Dr. Sarah M.

Principal Investigator

University Research Lab
January 2026

"Fast shipping and excellent packaging. Products arrived in perfect condition with proper cold chain maintenance. The purity levels consistently meet or exceed stated specifications."

Michael R.

Lab Manager

Private Research Facility
December 2025

"We've tested multiple suppliers and Peak Revival Plus offers the best combination of quality and documentation. Their BPC-157 showed excellent results in our in-vitro wound healing assays."

Dr. Jennifer K.

Research Scientist

Biotech Company
January 2026

"As a grad student, I appreciate the detailed product information and responsive customer service. They answered all my questions about storage and reconstitution protocols."

David L.

Graduate Researcher

State University
November 2025
500+
Research Labs Served
4.9/5
Average Rating
99%
Reorder Rate
2+ Years
In Business
Research Use Only
|
Not for Human Consumption
|
Not for Veterinary Use
PEAK REVIVAL+

Premium research peptides for scientific discovery. 99% purity guaranteed.

Quick Links

  • Home
  • Products
  • About Us
  • Compliance
  • Track Order
  • Help Center

Policies

  • Terms of Service
  • Privacy Policy
  • Refund Policy
  • Shipping Policy
  • Research Disclaimer
  • Email Preferences

Contact

  • General Inquiries:[email protected]
  • Shipping Questions:[email protected]

Research Use Only: All products sold by Peak Revival Plus are intended strictly for in vitro research and laboratory use only. Not for human consumption, veterinary use, or any clinical/therapeutic applications. By purchasing, you certify you are at least 21 years of age and will use products solely for legitimate research purposes.

© 2026 Peak Revival Plus™. All rights reserved.
Terms·Privacy·Disclaimer

Age Verification

Are you at least 21 years old?

By confirming, you verify that you are 21 or older and understand these products are not for human consumption.