Peak Revival Plus research peptides
New Customer ExclusiveEnds April 30th

30% OFF Your First Order

Limited time — code PRPLUS30 auto-applies at checkout. Offer ends April 30th.

Sign Up & Save
Peak Revival Plus
ProductsCOA LibraryAboutCompliance
Sign In
Products/TB-500
TB-500

View Certificate of Analysis

Verified

TB-500

Thymosin Beta-4

≥98%

Molecular Weight

4963.44 Da

Amino Acid Sequence

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Description

TB-500 is a synthetic peptide fragment studied in cellular research for its role in actin binding and cellular modeling. Widely used in laboratory protocols for in vitro analysis.

Research Applications

Cellular modeling, actin binding studies, in vitro research

Storage Conditions

Store lyophilized at -20°C. Reconstituted solutions stable at 4°C for 7 days.

30% OFF with code PRPLUS30
03:59:57

Limited time — offer ends April 30th. Don't miss out!

16 people viewing now52+ bought in last 24 hours
FREE 2–3 Day Shipping
All US orders ship free

Order

1
$85.00
2xSave 4%
$81.60/ea
4xSave 8%
$78.20/ea
6xSave 11%
$75.65/ea
Free Shipping
Purity Guaranteed

Ships today if ordered by 12 PM PST (Mon–Fri)

Frequently Bought Together

Researchers commonly pair these products

TB-500

TB-500

10mg

$85.00

BAC WATER 3ML

BAC WATER 3ML

3ML Vial

$7.00

Bundle Total

$92.00

Quality Certifications

≥98% Purity Guaranteed

All products meet strict purity standards

Certificate of Analysis

View verified COAs for all products

HPLC Verified

Third-party lab testing for accuracy

GMP Standards

Manufactured following WHO guidelines

View Certificate of Analysis (COA)

Every batch is independently tested by third-party laboratories. View the verified COA for TB-500 with purity data, HPLC chromatogram, and mass spectrometry results.

USA BasedSecure Checkout500+ Labs Served

Frequently Asked Questions

Common questions about TB-500 (Thymosin Beta-4). Can't find what you're looking for? Contact our research support team.

TB-500 is a synthetic peptide fragment of Thymosin Beta-4 (Tβ4), a naturally occurring 43-amino acid protein. TB-500 specifically represents the active region responsible for actin binding and cell migration properties studied in tissue repair research. It is more stable and cost-effective than full-length Tβ4 for research applications.

Reconstitute with bacteriostatic water using sterile technique. For a 5mg vial, add 2mL of BAC water for a 2.5mg/mL concentration. Inject slowly along the vial wall and swirl gently. Reconstituted TB-500 is stable at 4°C for up to 7 days.

Lyophilized TB-500 maintains ≥95% stability for 24+ months when stored at -20°C. After reconstitution, store at 4°C and use within 7 days for optimal activity.

Every batch is independently tested by accredited third-party laboratories with full Certificates of Analysis (COA) available on request. We guarantee ≥98% purity across our catalog, use pharmaceutical-grade lyophilization, and ship with cold-chain packaging to preserve compound integrity. Our research-grade peptides are manufactured under strict GMP-compliant conditions, ensuring consistency and reliability that many competitors cannot match.

Yes. We can provide HPLC, mass spectrometry, endotoxin testing, and amino acid analysis reports for any product. If you need a specific assay or custom testing protocol for your research, contact us at [email protected] and we will coordinate with our laboratory partners to accommodate your requirements.

Absolutely. We offer tiered pricing for research institutions, universities, and laboratories ordering in volume. Discounts typically start at 10+ units and scale with quantity. Contact us at [email protected] with your institutional details and estimated quantities for a custom quote. We also support purchase orders (PO) for qualifying institutions.

All orders ship free with same-day processing (orders placed by 12 PM PST). Packages are sent via USPS Priority or UPS Ground with temperature-controlled packaging. Lyophilized peptides are shipped with cold packs to maintain stability. Domestic orders typically arrive within 2–3 business days. Tracking information is provided via email as soon as your order ships.

Due to the nature of research chemicals, we cannot accept returns on opened products. However, if your order arrives damaged, contaminated, or does not meet the stated purity specifications, we will replace it or issue a full refund. Please contact support within 48 hours of delivery with photos of any issues.

No. All products sold by Peak Revival Plus are strictly for in-vitro research and laboratory use only. They are not intended for human consumption, veterinary use, or any therapeutic application. By purchasing, you confirm that you understand and agree to these terms.

Trusted by Researchers

What Our Customers Say

Verified feedback from researchers and laboratories across the country

"Exceptional purity and consistency across batches. The COA documentation is thorough and matches our internal HPLC analysis. We've been ordering for our cellular signaling studies for over a year now."

Dr. Sarah M.

Principal Investigator

University Research Lab
January 2026

"Fast shipping and excellent packaging. Products arrived in perfect condition with proper cold chain maintenance. The purity levels consistently meet or exceed stated specifications."

Michael R.

Lab Manager

Private Research Facility
December 2025

"We've tested multiple suppliers and Peak Revival Plus offers the best combination of quality and documentation. Their BPC-157 showed excellent results in our in-vitro wound healing assays."

Dr. Jennifer K.

Research Scientist

Biotech Company
January 2026

"As a grad student, I appreciate the detailed product information and responsive customer service. They answered all my questions about storage and reconstitution protocols."

David L.

Graduate Researcher

State University
November 2025
500+
Research Labs Served
4.9/5
Average Rating
99%
Reorder Rate
2+ Years
In Business
Research Use Only
|
Not for Human Consumption
|
Not for Veterinary Use
PEAK REVIVAL+

Premium research peptides. 99% purity. Lab-tested and verified.

Shop

  • All Products
  • COA Library
  • Track Order
  • Help Center

Company

  • About
  • Compliance
  • Terms of Service
  • Privacy Policy
  • Refund Policy
  • Shipping Policy

Contact

  • [email protected]
  • [email protected]

Research Use Only: All products sold by Peak Revival Plus are intended strictly for in vitro research and laboratory use only. Not for human consumption, veterinary use, or any clinical/therapeutic applications. By purchasing, you certify you are at least 21 years of age and will use products solely for legitimate research purposes.

© 2026 Peak Revival Plus, LLC. All rights reserved.
Terms·Privacy·Disclaimer

Age Verification

Are you at least 21 years old?

By confirming, you verify that you are 21 or older and understand these products are not for human consumption.