
TB-500
Thymosin Beta-4
Molecular Weight
4963.44 Da
Amino Acid Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Scientific Description
TB-500 is a synthetic peptide fragment studied in cellular research for its role in actin binding and cellular modeling. Widely used in laboratory protocols for in vitro analysis.
Research Applications
Cellular modeling, actin binding studies, in vitro research
Storage Conditions
Store lyophilized at -20°C. Reconstituted solutions stable at 4°C for 7 days.
Your discount expires soon - don't miss out!
Order Information

TB-500 (10mg)
Ships today if ordered and paid by 12 PM PST. (Except Saturdays & Sundays)
Quality Certifications
All products meet strict purity standards
COA included with every order
Third-party lab testing for accuracy
Manufactured following WHO guidelines
Certificate of Analysis (COA) Included
Every order includes a detailed COA with HPLC chromatogram, mass spectrometry data, and purity verification. Request the COA for TB-500 via email after purchase.
Frequently Asked Questions
Common questions about TB-500 (Thymosin Beta-4). Can't find what you're looking for? Contact our research support team.
TB-500 is a synthetic peptide fragment of Thymosin Beta-4 (Tβ4), a naturally occurring 43-amino acid protein. TB-500 specifically represents the active region responsible for actin binding and cell migration properties studied in tissue repair research. It is more stable and cost-effective than full-length Tβ4 for research applications.
Reconstitute with bacteriostatic water using sterile technique. For a 5mg vial, add 2mL of BAC water for a 2.5mg/mL concentration. Inject slowly along the vial wall and swirl gently. Reconstituted TB-500 is stable at 4°C for up to 7 days.
Lyophilized TB-500 maintains ≥95% stability for 24+ months when stored at -20°C. After reconstitution, store at 4°C and use within 7 days for optimal activity.
Every batch is independently tested by accredited third-party laboratories with full Certificates of Analysis (COA) available on request. We guarantee ≥98% purity across our catalog, use pharmaceutical-grade lyophilization, and ship with cold-chain packaging to preserve compound integrity. Our research-grade peptides are manufactured under strict GMP-compliant conditions, ensuring consistency and reliability that many competitors cannot match.
Yes. We can provide HPLC, mass spectrometry, endotoxin testing, and amino acid analysis reports for any product. If you need a specific assay or custom testing protocol for your research, contact us at [email protected] and we will coordinate with our laboratory partners to accommodate your requirements.
Absolutely. We offer tiered pricing for research institutions, universities, and laboratories ordering in volume. Discounts typically start at 10+ units and scale with quantity. Contact us at [email protected] with your institutional details and estimated quantities for a custom quote. We also support purchase orders (PO) for qualifying institutions.
All orders ship within 1–2 business days via USPS Priority or UPS Ground with temperature-controlled packaging. Lyophilized peptides are shipped with cold packs to maintain stability. Domestic orders typically arrive within 3–5 business days. Tracking information is provided via email as soon as your order ships.
Due to the nature of research chemicals, we cannot accept returns on opened products. However, if your order arrives damaged, contaminated, or does not meet the stated purity specifications, we will replace it or issue a full refund. Please contact support within 48 hours of delivery with photos of any issues.
No. All products sold by Peak Revival Plus are strictly for in-vitro research and laboratory use only. They are not intended for human consumption, veterinary use, or any therapeutic application. By purchasing, you confirm that you understand and agree to these terms.
What Our Customers Say
Verified feedback from researchers and laboratories across the country
"Exceptional purity and consistency across batches. The COA documentation is thorough and matches our internal HPLC analysis. We've been ordering for our cellular signaling studies for over a year now."
Principal Investigator
"Fast shipping and excellent packaging. Products arrived in perfect condition with proper cold chain maintenance. The purity levels consistently meet or exceed stated specifications."
Lab Manager
"We've tested multiple suppliers and Peak Revival Plus offers the best combination of quality and documentation. Their BPC-157 showed excellent results in our in-vitro wound healing assays."
Research Scientist
"As a grad student, I appreciate the detailed product information and responsive customer service. They answered all my questions about storage and reconstitution protocols."
Graduate Researcher
